PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G005216.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family TALE
Protein Properties Length: 343aa    MW: 38858.4 Da    PI: 6.1848
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G005216.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox277.9e-092713062055
                           HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
              Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                           +k +yps++++  LA+++gL+ +q+ +WF N+R ++
  HL.SW.v1.0.G005216.1 271 YKWPYPSEAQKLALAESTGLDLKQINNWFINQRKRH 306
                           5679*****************************885 PP

2ELK414.1e-14226247122
                   ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                           ELK qLlrKYsgyLgsLkqEF+
  HL.SW.v1.0.G005216.1 226 ELKVQLLRKYSGYLGSLKQEFL 247
                           9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.2E-1685129IPR005540KNOX1
PfamPF037904.4E-1987122IPR005540KNOX1
SMARTSM012565.1E-25140191IPR005541KNOX2
PfamPF037917.9E-21146190IPR005541KNOX2
SMARTSM011883.2E-7226247IPR005539ELK domain
PROSITE profilePS5121311.278226246IPR005539ELK domain
PfamPF037895.9E-10226247IPR005539ELK domain
PROSITE profilePS5007111.969246309IPR001356Homeobox domain
SMARTSM003891.7E-11248313IPR001356Homeobox domain
SuperFamilySSF466891.45E-19248324IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.2E-28251311IPR009057Homeodomain-like
CDDcd000861.61E-11258310No hitNo description
PfamPF059205.9E-17266305IPR008422Homeobox KN domain
PROSITE patternPS000270284307IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MDQFGEKSGT STSGVSSSML MMNKNRDNNN NNNMSLSFAT GNHRVTGAEI NIPQDSRTNG  60
NYSKHFYTEN NNTTTATTSN SSSSAKMRAK IMAHPLFPRL LTAYANCQKV GAPPEVVARL  120
EEEFNYNYNN ISRSTSGACS GEDNQPDPAL DQFMEAYCEM LTKYEEELTK PFKEAMLFLS  180
RVECQLKALT VSSTTDSGLG GQNGSSEEEL EMNEDGFIDP QAEDKELKVQ LLRKYSGYLG  240
SLKQEFLKKK KNGKLPKEAR QQLLEWWSRH YKWPYPSEAQ KLALAESTGL DLKQINNWFI  300
NQRKRHWKPS EDMQFVVMDA AHPGHYYMDN IMYNPFSMDT VL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010089440.11e-144Homeobox protein
SwissprotQ388741e-123STM_ARATH; Homeobox protein SHOOT MERISTEMLESS
TrEMBLW9QQI91e-144W9QQI9_9R
STRINGVIT_10s0116g00190.t011e-134(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-117KNOX/ELK homeobox transcription factor